General Information

  • ID:  hor003238
  • Uniprot ID:  A0A1L8EM03
  • Protein name:  Ile-enkephalin
  • Gene name:  pdyn.S
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  Opioid neuropeptide precursor family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YGGFI
  • Length:  5(96-100)
  • Propeptide:  MRWFTLVMFLSLSALQGIHGDCVSKCFSCSLQMKALSAKFNPLVCSLQCEGSLLQDDEWERCGQLLSSQEEILEVKREQELVSPLSDSQVMLVKRYGGFIRKPDKYKFLNAKRENTGFSKRYGGFLRKYTLRDLQDLSSNPEIMLESPDAEETGWSIPSWDMLDERKRYGGFLRKYPKRSPAQEGDSEEGLGRKRRLQEGLESGPAILTGQEIETGREVDLEHGTAELEKRYGGFLRRIRPKLRWDNQKRYGGFL
  • Signal peptide:  MRWFTLVMFLSLSALQGIHG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A1L8EM03-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003238_AF2.pdbhor003238_ESM.pdb

Physical Information

Mass: 62716 Formula: C28H37N5O7
Absent amino acids: ACDEHKLMNPQRSTVW Common amino acids: G
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: 104 Boman Index: 964
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 78
Instability Index: 1570 Extinction Coefficient cystines: 1490
Absorbance 280nm: 372.5

Literature

  • PubMed ID:  18977279
  • Title:  Binding studies of novel, non-mammalian enkephalins, structures predicted from frog and lungfish brain cDNA sequences.